MG_196_MONOMER – translation initiation factor IF-3

Name
WID MG_196_MONOMER View in model
Name translation initiation factor IF-3 View in model
Cross references PDB: 2IFE
 
Genetics
Gene MG_196 View in model
 
Structure
Sequence
1
51
101
151
LAQNAKHPSKKEQKPLVNEQIAFNQFTLIDENSTNLGIVKMENALKLAQE
KQLDLVLIAPNPTKPIVKLLDFGRYTYDLKRKKRQAKKNQTIIQTKEVVV
KPTIAKHDLEFRAKQSKNWIEKGHHVKFIVRAFGRVSTRIELIEKVFDDF
YQLVKDVVEIQKPLTASSKTMYAALLVPLKR*
50
100
150
182
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1574C953N261O261S2
Molecular weight (pH 7.5; Da) 20928.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11460
Instability index 32.97
Is stable True
Aliphatic index 99.62
GRAVY (25C, pH 7.0) -0.435
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit 30S ribosomal subunit - translation initiation factor IF-3 complex
[c]: MG_196_MONOMER + RIBOSOME_30SRIBOSOME_30S_IF3
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0096].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33