MG_195_MONOMER – phenylalanyl-tRNA synthetase, beta subunit

Name
WID MG_195_MONOMER View in model
Name phenylalanyl-tRNA synthetase, beta subunit View in model
 
Genetics
Gene MG_195 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
MLISKKTLGVLIPDIFSFSNDQIAQKLEQMGIEVESIKQFNSPDYLQLAK
VVSIQPHPHDNKLFICELQIDKNKFINVVSNANNINNPDNINKFVIVAKK
GTELLNGLIVKTQNIKGIISEGILCSYIDINPFSRQIIEKTEVADAIIID
HVSNDHDWNQYLSFLSLDDVIFDVKTPTNRADLHSLIFLAKELGVLLKTK
TFLKQKSSVVNHDFFKFPLNLKNKLKANYFGGLFLRQINQHSSPWTVKGL
LINQMIKPVNYYVDKANLVTVFTAQPIHCHDADRIVGNIELKQATHNETF
VGLDDKQYEIEPGDIVVCDEKGIIALVGIIGSKRTMVQPTTTNIFFEVVN
CNSETIKQTAKRFLINNFASKFMVKPISLLATDNCLNYLQNSLLTTDNIG
KISHFSSSLKVEPFSKKLTVNFHKIRQLIGIEKKELTDQTIKKSLSQLGF
KVDNQLLKIPSYRQDINTWQDISEEIVKLIDINKLKPIGITSSFNFEKSS
YFNTFNALTKLRKKLQTLGFHNVITYQLTDQKSAKTFNLFNLENFITIKN
PVSQNHSVMRVSLIDSLLKVLKTNNNYKNELVNIFEFSFIKTQNNSELHL
AVLWVEKLFTSSFNPMQGISNDVFTMKGLAKLIVANLGFSCDFEPLDDSD
YFVNNQSLKIVVFNEQIGFIGLIKESLLNNYDLNNKPIYCLEINLDRMLS
SLNRIEKNYLGYSKLQPVCKDLTFSFTNPASHFDQFANMIKRITGIESWK
LISVFETMQNNQLITKYTVRYFLKNDANKPLTNQTIELITNNLKLQCEKL
KIKLDI*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
807
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H6661C4188N1082O1207S21
Molecular weight (pH 7.5; Da) 92154.32 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
57060
Instability index 27.97
Is stable True
Aliphatic index 104.19
GRAVY (25C, pH 7.0) -0.139
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit phenylalanyl-tRNA synthetase
[c]: (2) MG_194_MONOMER + (2) MG_195_MONOMERMG_194_195_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_194_195_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33