MG_194_MONOMER – phenylalanyl-tRNA synthetase, alpha subunit

Name
WID MG_194_MONOMER View in model
Name phenylalanyl-tRNA synthetase, alpha subunit View in model
 
Genetics
Gene MG_194 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MIDQNKLITKWKKAFAKAKNLTTLVNLKNTLHNSDLKPLLQKIKTATKLS
EKSSLGKLYQSLDIQLTDLLTSYKKTFEINNQVSQKPSLDVMLPATEFTN
GSNNALYQVIDNLVEYFKSFLFTINFDSELTSISDCFDLLNIPKDHSSRN
ESDSFYIDKTSLLRTHCTATTLKAVRTSKKTNNPDIRVVSLGAVFRNDSD
DATHSHQFTQLDFMWIKKGLSLANLKWFINNMITHFFGENTFTRFRLSHF
PFTEPSFEIDIRCWLCQNGCSICKQTKWIEILGAGIIHPQVMNNMGIGDT
ENITGIAAGIGIERLAMLKYGIDDIRDFYDNNFKFLTQFTD*
50
100
150
200
250
300
342
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2744C1754N461O518S13
Molecular weight (pH 7.5; Da) 38994.07 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38680
Instability index 26.59
Is stable True
Aliphatic index 86.99
GRAVY (25C, pH 7.0) -0.272
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit phenylalanyl-tRNA synthetase
[c]: (2) MG_194_MONOMER + (2) MG_195_MONOMERMG_194_195_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_194_195_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33