MG_192_MONOMER – P110 protein

Name
WID MG_192_MONOMER View in model
Name P110 protein View in model
 
Genetics
Gene MG_192 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
MKTMRKQIYKKAYWLLLPFLPLALANTFLVKEDSKNVTAYTPFATPITDS
KSDLVSLAQLDSSYQIADQTIHNTNLFVLFKSRDVKVKYESSGSNNISFD
STSQGEKPSYVVEFTNSTNIGIKWTMVKKYQLDVPNVSSDMNQVLKNLIL
EQPLTKYTLNSSLAKEKGKTQREVHLGSGQANQWTSQRNQHDLNNNPSPN
ASTGFKLTTGNAYRKLSESWPIYEPIDGTKQGKGKDSSGWSSTEENEAKN
DAPSVSGGGSSSGTFNKYLNTKQALESIGILFDDQTPRNVITQLYYASTS
KLAVTNNHIVVMGNSFLPSMWYWVVERSAQENASNKPTWFANTNLDWGED
KQKQFVENQLGYKETTSTNSHNFHSKSFTQPAYLISGIDSVNDQIIFSGF
KAGSVGYDSSSSSSSSSSSSTKDQALAWSTTTSLDSKTGYKDLVTNDTGL
NGPINGSFSIQDTFSFVVPYSGNHTNNGTTGPIKTAYPVKKDQKSTVKIN
SLINATPLNSYGDEGIGVFDALGLNYNFKSNQERLPSRTDQIFVYGIVSP
NELRSAKSSADSTGSDTKVNWSNTQSRYLPVPYNYSEGIIDADGFKRPEN
RGASVTTFSGLKSIAPDGFANSIANFSVGLKAGIDPNPVMSGKKANYGAV
VLTRGGVVRLNFNPGNDSLLSTTDNNIAPISFSFTPFTAAESAVDLTTFK
EVTYNQESGLWSYIFDSSLKPSHDGKQTPVTDNMGFSVITVSRTGIELNQ
DQATTTLDVAPSALAVQSGIQSTTQTLTGVLPLSEEFSAVIAKDSDQNKI
DIYKNNNGLFEIDTQLSNSVATNNGGLAPSYTENRVDAWGKVEFADNSVL
QARNLVDKTVDEIINTPEILNSFFRFTPAFEDQKATLVATKQSDTSLSVS
PRIQFLDGNFYDLNSTIAGVPLNIGFPSRVFAGFAALPAWVIPVSVGSSV
GILFILLVLGLGIGIPMYRVRKLQDASFVNVFKKVDTLTTAVGSVYKKII
TQTGVVKKAPSALKAANPSVKKPAAFLKPPVQPPSKPEGEQKAVEVKSEE
TKS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1054
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7951C5096N1354O1624S9
Molecular weight (pH 7.5; Da) 114457.02 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
127660
Instability index 30.58
Is stable True
Aliphatic index 76.57
GRAVY (25C, pH 7.0) -0.377
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tm View in model
 
Comments
Comments signal peptide length 25 [PUB_0284] Signal Peptipde Signal peptide of length 25 (SPdb152770, MKTMRKQIYKKAYWLLLPFLPLALA) predicted by SPdb [PUB_0253].
References
  1. Catrein I, Herrmann R, Bosserhoff A, Ruppert T. Experimental proof for a signal peptidase I like activity in Mycoplasma pneumoniae, but absence of a gene encoding a conserved bacterial type I SPase. FEBS J 272, 2892-900 (2005). WholeCell: PUB_0284, PubMed: 15943820

  2. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33