MG_191_MONOMER – MgPa adhesin

Name
WID MG_191_MONOMER View in model
Name MgPa adhesin View in model
 
Genetics
Gene MG_191 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
1251
1301
1351
1401
MHQPKKRLAKKSWAFLTAALTLGVITGVGGYFLFNQNKQRSSVSNFAYQP
KQLSVKHQQAVDETLTPWTWNNNNFSSLKITGENPGSFGLVRSQNDNLNI
SSVTKNSSDDNLKYLNAVEKYLDGQQNFAIRRYDNNGRALYDINLAKMEN
PSTVQRGLNGEPIFDPFKGFGLTGNAPTDWNEIKGKVPVEVVQSPHSPNL
YFVLLVPKVALEYHNLNNQVVKESLEVKATQSSFNPTQRLQKDSPVKDSS
KQGEKLSETTASSMSSGMATSTRAKALKVEVERGSQSDSLLKNDFAKKPL
KHKNSSGEVKLEAEKEFTEAWKPLLTTDQIAREKGMGATVVSFYDAPYSE
NHTAFGLVDHIDPKKMVENYPPSWKTPKWNHHGIWDYNARNLLLQTTGFF
NPRRHPEWFDEGQAKADNTSPGFKVGDTDHKKDGFKKNSSSPIALPFEAY
FANIGNMVAIGNSVFIFGGNGHATKMFTTNPLSIGVFRIKYTDNFSKSSV
TGWPYAVLFGGLINPQTNGLKDLPLGTNRWFEYVPRMAVSGVKWVGNQLV
LAGTLTMGDTATVPRLKYDQLEKHLNLVAQGQGLLREDLQIFTPYGWANR
PDIPVGAWLQDEMGSKFGPHYFLNNPDIQDNVNNDTVEALISSYKNTDKL
KHVYPYRYSGLYAWQLFNWSNKLTNTPLSANFVNENSYAPNSLFAAILNE
DLLTGLSDKIFYGKENEFAENEADRFNQLLSLNPNPNTNWARYLNVVQRF
TTGPNLDSSTFDQFLDFLPWIGNGKPFSNSPSPSTSASSSTPLPTFSNIN
VGVKSMITQHLNKENTRWVFIPNFSPDIWTGAGYRVQSANQKNGIPFEQV
KPSNNSTPFDPNSDDNKVTPSGGSSKPTTYPALPNSISPTSDWINALTFT
NKNNPQRNQLLLRSLLGTIPVLINKSGDSNDQFNKDSEQKWDKTETNEGN
LPGFGEVNGLYNAALLHTYGFFGTNTNSTDPKIGFKADSSSSSSSTLVGS
GLNWTSQDVGNLVVINDTSFGFQLGGWFITFTDFIRPRTGYLGITLSSLQ
DQTIIWADQPWTSFKGSYLDSDGTPKSLWDPTALKSLPNSSTTYDTNPTL
SPSFQLYQPNKVKAYQTTNTYNKLIEPVDATSAATNMTSLLKLLTTKNIK
AKLGKGTASSQGNNNGGGVSQTINTITTTGNISEGLKEETSIQAETLKKF
FDSKQNNKSEIGIGDSTFTKMDGKLTGVVSTPLVNLINGQGATSDSDTEK
ISFKPGNQIDFNRLFTLPVTELFDPNTMFVYDQYVPLLVNLPSGFDQASI
RLKVISYSVENQTLGVRLEFKDPQTQQFIPVLNASSTGPQTVFQPFNQWA
DYVLPLIVTVPIVVIILSVTLGLTIGIPMHRNKKALQAGFDLSNKKVDVL
TKAVGSVFKEIINRTGISNAPKKLKQATPTKPTPKTPPKPPVKQ*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1350
1400
1445
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H11092C7173N1916O2187S16
Molecular weight (pH 7.5; Da) 159672.94 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
215090
Instability index 31.71
Is stable True
Aliphatic index 74.27
GRAVY (25C, pH 7.0) -0.489
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tm View in model
 
Comments
Comments signal peptide length 69 [PUB_0088] Signal Peptipde Signal peptide of length 30 (SPdb5995, MHQPKKRLAKKSWAFLTAALTLGVITGVGG) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

  2. Razin S, Jacobs E. Mycoplasma adhesion. J Gen Microbiol 138, 407-22 (1992). WholeCell: PUB_0088, PubMed: 1593256

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33