MG_190_MONOMER – phosphoesterase

Name
WID MG_190_MONOMER View in model
Name phosphoesterase View in model
 
Genetics
Gene MG_190 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKKGSITEAINAIKQFDKIVIFHHVRPDGDCLGAQQGLFHLIKANFKNKE
VKCVGNNNNLFSFINMTFTNQIDESFLKEALAIVVDANYKNRIELRELLD
KNLFKAVLRIDHHPNEDDLNTSFNFVEESYVACCEQIVEMATVAKWTIPP
VAATLLYIGIYTDSNRFLYSNTSYRTLYLAAILYKAKADIRIVHDHLNHT
SLADLKFKKYVYNHFKTQGQVIYFICTKKIQKRLRMTADQCARVNLLSNI
ADYKIWLFFIEQANNEIRIELRSNGINVRDIAIKYGGGGHNNASGAIITN
KKQISDVVSDCVKKIVYN*
50
100
150
200
250
300
319
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2596C1644N447O466S11
Molecular weight (pH 7.5; Da) 36431.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
32735
Instability index 21.12
Is stable True
Aliphatic index 99.06
GRAVY (25C, pH 7.0) -0.162
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0148]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [146].
References
  1. Han ES, Cooper DL, Persky NS, Sutera VA Jr, Whitaker RD, Montello ML, Lovett ST. RecJ exonuclease: substrates, products and interaction with SSB. Nucleic Acids Res 34, 1084-91 (2006). WholeCell: PUB_0148, PubMed: 16488881

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33