MG_188_MONOMER – Oligosaccharide or polyol ABC transporter, permease protein

Name
WID MG_188_MONOMER View in model
Name Oligosaccharide or polyol ABC transporter, permease protein View in model
 
Genetics
Gene MG_188 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MFKWLLKHHNQPHSLQLGLLDQPLPFWKPFLLFLPALLTTILFTIIPFFL
SLQKGFSANSDLYDLSSQSFSLRTFQDLFSESNFVLGLRNSFLYSLISLP
FSIIIAIVIASAIVFVYKKLLRGFWQTVFFLPYVTSGVAISIAFVYIFDS
ASGILNTVFNVNTKWLDSGSRDTFNALWAILIFGVWKNLAFNVLIISTAM
LSVNPQLYKVASLDSANPVRQFFKITLPSIRPTLIFLTTLLILGGMQVFP
LALFENKPEEAVANGGNSILLYIFQQIQSGNTNLAGAATLVLFVLGVCYG
LVLRNGFYLIEWLQWKIKQLYVQKQLTLY*
50
100
150
200
250
300
330
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2729C1782N413O447S4
Molecular weight (pH 7.5; Da) 37218.39 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
60515
Instability index 37.96
Is stable True
Aliphatic index 124.67
GRAVY (25C, pH 7.0) 0.653
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit Oligosaccharide or polyol ABC transporter
(2) MG_186_MONOMER[e] + MG_187_MONOMER[c] + MG_188_MONOMER[m] + MG_189_MONOMER[m] ⇒ MG_186_187_188_189_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_186_187_188_189_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:33