MG_187_MONOMER – Oligosaccharide or polyol ABC transporter, ATP-binding protein

Name
WID MG_187_MONOMER View in model
Name Oligosaccharide or polyol ABC transporter, ATP-binding protein View in model
 
Genetics
Gene MG_187 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MANNKSAIELKNIVVDFGESVAIDNINLSVEKHQLVSLLGPSGCGKTTTL
AVIAGLIKPTSGQVLFNGYDVTKKPPQERKLGLVFQNYALYPHMNVFENI
VFPLYSDNSWKQAVLEKNSVANHEINCLLLTSNGASVQEIDQLNKLFHDS
IEKPKQIQYQINDLNVSVFKNLNELTANLKLIPSKHQFAITNLNKQTLKQ
INELEAEFKTKWKLQKQTPIKSGVEHNAKLQAIKQHFSYEKQRLKKHYFK
TKVELKQTLVENLKLVKKAISEQTKLIKQSSDYTKLKQLKRLIKVEPNQL
KKQYKVFLNQLIKNYSLKTDKLTDTQLNEIEQIKTRIVSIKQFINKTALE
VANKLAITKILTKRPDKISGGQQQRVAIARAIVRRPKLLLMDEPLSNLDA
KLRVQTRQWIRQFQQELQITTVFVTHDQEEAMSISDVIVCMSTGKVQQIG
TPSELYLKPANEFVARFLGTPEMNIIECSVKNNQLFWNNHLLVTESFKLN
VEKLLVGFRYEQLVVTTNKSSLQAKLINIENLGKHLVATISLFDTTLSMR
LELNSHLKVGDSLNFIIKANNLHFFDIDTKQRIEI*
50
100
150
200
250
300
350
400
450
500
550
586
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4946C3020N819O869S11
Molecular weight (pH 7.5; Da) 66985.07 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
40380
Instability index 34.86
Is stable True
Aliphatic index 104.93
GRAVY (25C, pH 7.0) -0.311
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit Oligosaccharide or polyol ABC transporter
(2) MG_186_MONOMER[e] + MG_187_MONOMER[c] + MG_188_MONOMER[m] + MG_189_MONOMER[m] ⇒ MG_186_187_188_189_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_186_187_188_189_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:32