MG_186_MONOMER – Oligosaccharide or polyol ABC transporter, substrate binding protein

Name
WID MG_186_MONOMER View in model
Name Oligosaccharide or polyol ABC transporter, substrate binding protein View in model
 
Genetics
Gene MG_186 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKGFLKPNFSLGALFLTLSPIATACIAEKPVNNRFNFNSEQLARLRKARV
NHWRDGDTLEVSFANNHQKPIRIYAIDTPEKAVLSIQRKSEIELKEANKA
TEFAKSLIPIGSEVWIWPLNSYSYDREVAAVFFKTNPLQLHFESFAVEMV
ANGHALPIAGNDFDFVFSDLDPFNPLKIVGIELANGLNNAFNNRKNIFSY
LENSFQSITMVYQQRGVDQSWTRYLAPSNDFSSTKLGLGLTIYELKLNNG
*
50
100
150
200
250
251
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 24 (nt) View in model
Empirical formula (pH 7.5) H1979C1289N342O369S4
Molecular weight (pH 7.5; Da) 28298.76 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
32555
Instability index 23.80
Is stable True
Aliphatic index 88.65
GRAVY (25C, pH 7.0) -0.218
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit Oligosaccharide or polyol ABC transporter
(2) MG_186_MONOMER[e] + MG_187_MONOMER[c] + MG_188_MONOMER[m] + MG_189_MONOMER[m] ⇒ MG_186_187_188_189_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_186_187_188_189_PENTAMER). Signal Peptipde Signal peptide of length 24 (SPdb328701, MKGFLKPNFSLGALFLTLSPIATA) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:52
Last updated 2012-10-01 15:14:32