MG_184_MONOMER – adenine-specific DNA modification methylase

Name
WID MG_184_MONOMER View in model
Name adenine-specific DNA modification methylase View in model
 
Genetics
Gene MG_184 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
VHHFNRAKKAKNNEFFTLIDEIENEVINYQKQFANKTIFCNCNDGKNSHF
FQFFQTNFNQLQLKKLIGFSFNNLSQADKFTFDGNKVTKTKLKGNGDFSS
DESIEVLKQADIVVTNPPFSLFQSFIDLLIQHNKQFLVLGLNAAVSYNHI
FTYFKTNKLWFGYTVNKTMSFSVNSDYQLYNPKTSNFFTKNGKCFQKIAG
ISWFTNLGKPHYNPFLNTNCFYKNNEKNYPKFDWYDAIYVNKIKNIPMDW
NGLMGVPLTFLNCYNPKQFELVDCLANPYATLDTLKTNAFVKLNQGDVRN
VNGKRRYVRVIIKKQQI*
50
100
150
200
250
300
318
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2575C1704N441O470S9
Molecular weight (pH 7.5; Da) 37046.83 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
43610
Instability index 25.40
Is stable True
Aliphatic index 72.92
GRAVY (25C, pH 7.0) -0.449
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit adenine-specific DNA modification methylase
[c]: (2) MG_184_MONOMERMG_184_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as dimer [PUB_0652, PUB_0653]. May also be functional as monomer or tetramer [PUB_0095, PUB_0652, PUB_0653]. Coenzymes Monomer interacts with CA or MG with unknown stoichiometry as prosthetic group [46].
References
  1. Brocchi M, de Vasconcelos ATR, Zaha A. Restriction-modification systems in Mycoplasma spp. Genet. Mol. Biol , (2007). WholeCell: PUB_0652, URL: http://www.scielo.br/scielo.php?pid=S1415-47572007000200011&script=sci_arttext

  2. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

  3. Wilson GG, Murray NE. Restriction and modification systems. Annu Rev Genet 25, 585-627 (1991). WholeCell: PUB_0653, PubMed: 1812816

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:32