MG_183_MONOMER – oligoendopeptidase F

Name
WID MG_183_MONOMER View in model
Name oligoendopeptidase F View in model
 
Genetics
Gene MG_183 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MKNSYKWDLSVLLNNQSLQANFLKIQTVSEALIKAYNNGLCFTNKTSFEQ
FLAIDDKFTELENRYTNYLYNKQNENNLDKEVNDAIFAYQSFKNNHNLAF
STLQQELYNHEKLIKDYLTDPKLAVYKRNLMLVFRDKPHQLSSQTQSLLS
QINPCFNQAERIFNILSTADLNLQPVVYQNKKYPINSVSDYQSLLENTNR
GIRKACYEKWIEIYWTNRNSLSLSLVENYIQLENFAKLKNHPSYIAQTAF
NDEIEVGFIDFVYQQVAQFAKTFQAFIRLKKQIYKHVLKVNKVEPYDLTL
TLFKTKKSYTIEQAKQDALKVLDLLGDNYIKIVKKAFNENWIDWLADKNK
YTGAYSISNVKGLEHFFILMNFDKTKSSLNTLVHELGHSVHSWYASQHQS
QNIDPTIFYAEIASIANELLLCYYELQLYKNNHKQLIASLLSQINHFFGA
TTRQIMFSQFEKDTLYLIRVNQKPDFKTLIKIYANTAVKYQGFKPEVVAN
KLKKTQYQKSLSHIIAIPHFYAGNFYVYKYAIGQVAGILVAKKINSGDKK
MKDNYFKFLSSGSSLAPLETIKLLGIDLTSPQPWQEAHNEVKRWLKIVKQ
SFKKLQK*
50
100
150
200
250
300
350
400
450
500
550
600
608
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H5048C3257N838O918S9
Molecular weight (pH 7.5; Da) 70920.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
99630
Instability index 30.97
Is stable True
Aliphatic index 91.92
GRAVY (25C, pH 7.0) -0.404
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Parameters
Parameters Parameter_0100: oligoendopeptidaseFSpecificRate = 27.474 1/s View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0036]. Coenzymes Interacts with 2 ZN per monomer as prosthetic group [34,35,96].
References
  1. Monnet V, Nardi M, Chopin A, Chopin MC, Gripon JC. Biochemical and genetic characterization of PepF, an oligopeptidase from Lactococcus lactis. J Biol Chem 269, 32070-6 (1994). WholeCell: PUB_0036, PubMed: 7798200

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:32