MG_180_MONOMER – metal ion (cobalt) ABC transporter, ATP-binding protein, putative

Name
WID MG_180_MONOMER View in model
Name metal ion (cobalt) ABC transporter, ATP-binding protein, putative View in model
 
Genetics
Gene MG_180 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
VKKKIVPINPLKADEILAVSHLSCVFNSKTNNPIKVIDDFSYTFQKNQIY
CIIGDSGSGKSTLVNHFNGLIKPNQGDIWVKDIYIGAKQRKIKNFKKLRK
TISIVFQFPEYQLFKDTVEKDIMFGPVALGQSKYDARQKAAYYLEMMGLK
YPFLERNPFELSGGQKRRVAIAGILAIEPEILIFDEPTAGLDPEGEREMM
QLIKTAKQQQRTVFMITHQMENVLEVADVVLVLAKGKLVKAASPYEVFMD
QTFLEKTTIVLPPVIQVIKDLIAINAHFNKLIELQPKNLEQLASAINKTI
ANHG*
50
100
150
200
250
300
305
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2521C1569N405O437S10
Molecular weight (pH 7.5; Da) 34370.81 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19160
Instability index 28.66
Is stable True
Aliphatic index 101.97
GRAVY (25C, pH 7.0) -0.106
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit metal ion (cobalt) ABC transporter
MG_179_MONOMER[c] + MG_180_MONOMER[c] + (2) MG_181_MONOMER[m] ⇒ MG_179_180_181_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_179_180_181_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:32