MG_177_MONOMER – DNA-directed RNA polymerase, alpha subunit

Name
WID MG_177_MONOMER View in model
Name DNA-directed RNA polymerase, alpha subunit View in model
Cross references PDB: 1XS9
 
Genetics
Gene MG_177 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MEKFLKYEIKVNNNQPTNTNPNYGIFEVAPLESGFGITIGNAMRRVLLSC
IPGASVFAIAISGVKQEFSNVEGVLEDVTEMVLNFKQLVVRISDLLFEDG
EMIEPPLERWPVLKVTAEKKGAVYAKDLECPAGFEVINKDLYLFSLQKDM
KLTVSVYVKQGRGFTSFLENRELINSLGIIATDANFSPVLHCGYEVQEVK
TSKQKLTDHLTFKIATNGAIKAVDAFAMAAKILIEHLNPIVSVNESIKNL
TIIQEKAEERKVKSFAKQIEELDFTVRTFNCLKRSGIHTLQELLSKSLTD
IREIRNLGKKSEREIIKKVQELGLKFRS*
50
100
150
200
250
300
329
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2689C1663N437O486S10
Molecular weight (pH 7.5; Da) 36901.32 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14940
Instability index 34.06
Is stable True
Aliphatic index 102.19
GRAVY (25C, pH 7.0) -0.0976
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit DNA-directed RNA polymerase
[c]: MG_022_MONOMER + (2) MG_177_MONOMER + MG_340_MONOMER + MG_341_MONOMERRNA_POLYMERASE
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see RNA_POLYMERASE). Crystal structure available of Thermus thermophilus RNA polymerase [PUB_0430]. Gram positive bacteria such as mycoplasmas contain additional delta factor beyond gram negative RNA polymerase [PUB_0423]. RNA polymerase holoenzyme has structure β'βα2δσ [PUB_0355].
References
  1. Achberger EC, Whiteley HR. The role of the delta peptide of the Bacillus subtilis RNA polymerase in promoter selection. J Biol Chem 256, 7424-32 (1981). WholeCell: PUB_0423, PubMed: 6788769

  2. Bordier C, Rossetti GP. Subunit composition of Escherichia coli RNA polymerase during transcription in vitro. Eur J Biochem 65, 147-53 (1976). WholeCell: PUB_0355, PubMed: 776624

  3. Vassylyev DG, Sekine S, Laptenko O, Lee J, Vassylyeva MN, Borukhov S, Yokoyama S. Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution. Nature 417, 712-9 (2002). WholeCell: PUB_0430, PubMed: 12000971

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:32