MG_173_MONOMER – translation initiation factor IF-1

Name
WID MG_173_MONOMER View in model
Name translation initiation factor IF-1 View in model
Cross references PDB: 1AH9, PDB: 1ZO1
 
Genetics
Gene MG_173 View in model
 
Structure
Sequence
1
51
MKNDKLFLTGKILEIIHGDKYRVMLENNVEVDAHLAGKMKMKRTKILPGD
VVEVEFSPYDLKLGRITQRK*
50
71
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H606C364N100O101S4
Molecular weight (pH 7.5; Da) 8127.55 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
2980
Instability index 25.43
Is stable True
Aliphatic index 98.73
GRAVY (25C, pH 7.0) -0.397
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0379]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Rasmussen LC, Jensen JM, Croitoru V, Sperling-Petersen HU, Mortensen KK. Production and epitope characterization of mAbs specific for translation factor IF1. Biochem Biophys Res Commun 364, 72-8 (2007). WholeCell: PUB_0379, PubMed: 17936721

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:32