MG_171_MONOMER – adenylate kinase

Name
WID MG_171_MONOMER View in model
Name adenylate kinase View in model
Cross references PDB: 1AKE, PDB: 4AKE
 
Genetics
Gene MG_171 View in model
 
Structure
Sequence
1
51
101
151
201
MVAQFNKFIILGPPGAGKGTVCKLLSKTTKLVHIASGDLFREAIKNQSVI
GRKIAAIISQGGYVDDATTNQLVYEYITTNPLPNGFILDGYPRTENQLDF
LNIKLTIDMVFELVVSDLNKLITRIDNRVICNNCNSVYNLLFQKPLVENS
CDQCSAKLVKRSDDNKAVVKARMELYQQTIQPIHTYFFNKQLLVQIDCFL
PLEEQLKTIKQFIR*
50
100
150
200
215
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1762C1093N289O314S9
Molecular weight (pH 7.5; Da) 24263.95 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
11180
Instability index 26.61
Is stable True
Aliphatic index 106.05
GRAVY (25C, pH 7.0) -0.0372
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0351]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
References
  1. Goelz SE, Cronan JE Jr. Adenylate kinase of Escherichia coli: evidence for a functional interaction in phospholipid synthesis. Biochemistry 21, 189-95 (1982). WholeCell: PUB_0351, PubMed: 6277367

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:31