MG_167_MONOMER – ribosomal protein L18

Name
WID MG_167_MONOMER View in model
Name ribosomal protein L18 View in model
Cross references PDB: 2Z4N
 
Genetics
Gene MG_167 View in model
 
Structure
Sequence
1
51
101
MTRNDKRRIRHKRIVKKIRLTNLNNRVVLIVIKSLKNISVQAWDFSKNVV
LTSSSSLQLKLKNGNKENAKLVGMDIATKLIKLNQKDVVFDTGGSKYHGR
IAALAEGARAKGLNF*
50
100
116
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H993C573N177O158S2
Molecular weight (pH 7.5; Da) 12954.20 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6990
Instability index 20.92
Is stable True
Aliphatic index 105.86
GRAVY (25C, pH 7.0) -0.338
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 50S ribosomal subunit
[c]: MGrrnA23S + MGrrnA5S + MG_081_MONOMER + MG_082_MONOMER + MG_093_MONOMER + MG_151_MONOMER + MG_152_MONOMER + MG_153_MONOMER + MG_154_MONOMER + MG_156_MONOMER + MG_158_MONOMER + MG_159_MONOMER + MG_161_MONOMER + MG_162_MONOMER + MG_163_MONOMER + MG_166_MONOMER + MG_167_MONOMER + MG_169_MONOMER + MG_174_MONOMER + MG_178_MONOMER + MG_197_MONOMER + MG_198_MONOMER + MG_232_MONOMER + MG_234_MONOMER + MG_257_MONOMER + MG_325_MONOMER + MG_361_MONOMER + MG_362_MONOMER + MG_363_MONOMER + MG_418_MONOMER + MG_426_MONOMER + MG_444_MONOMER + MG_466_MONOMER + MG_473_MONOMERRIBOSOME_50S
View in model
 
Comments
Comments First observed residue by mass-spec 15 [PUB_0280]. Functional Macromolecule Functional as part of 50S ribosomal particle.
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:51
Last updated 2012-10-01 15:14:31