MG_163_MONOMER – ribosomal protein L5

Name
WID MG_163_MONOMER View in model
Name ribosomal protein L5 View in model
Cross references PDB: 2Z4N
 
Genetics
Gene MG_163 View in model
 
Structure
Sequence
1
51
101
151
MNNLEKTYKTELVNQLQQQLGFSSIMQVPKLTKIVVNMGVGDAIRDNKFL
ESALNELHLITGQKPVATKAKNAISTYKLRAGQLIGCKVTLRNKKMWSFL
EKLIYIALPRVRDFRGLSLRSFDGKGNYTIGIKEQIIFPEIVYDDIKRIR
GFDITIVTSTNKDSEALALLRALKMPFVKE*
50
100
150
181
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H1528C925N250O258S6
Molecular weight (pH 7.5; Da) 20471.88 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
13075
Instability index 35.12
Is stable True
Aliphatic index 105.03
GRAVY (25C, pH 7.0) -0.136
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 50S ribosomal subunit
[c]: MGrrnA23S + MGrrnA5S + MG_081_MONOMER + MG_082_MONOMER + MG_093_MONOMER + MG_151_MONOMER + MG_152_MONOMER + MG_153_MONOMER + MG_154_MONOMER + MG_156_MONOMER + MG_158_MONOMER + MG_159_MONOMER + MG_161_MONOMER + MG_162_MONOMER + MG_163_MONOMER + MG_166_MONOMER + MG_167_MONOMER + MG_169_MONOMER + MG_174_MONOMER + MG_178_MONOMER + MG_197_MONOMER + MG_198_MONOMER + MG_232_MONOMER + MG_234_MONOMER + MG_257_MONOMER + MG_325_MONOMER + MG_361_MONOMER + MG_362_MONOMER + MG_363_MONOMER + MG_418_MONOMER + MG_426_MONOMER + MG_444_MONOMER + MG_466_MONOMER + MG_473_MONOMERRIBOSOME_50S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 50S ribosomal particle. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:50
Last updated 2012-10-01 15:14:31