MG_148_MONOMER

Name
WID MG_148_MONOMER View in model
 
Genetics
Gene MG_148 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MKYVKVQIINKSTIELLEDAKKGEKINLDLINQVDQTNILNTITTNQKLA
WEKELSAQFINQQNELIKNFEIEIIKLKTMLNDKEQALLLKTKLELQNQF
QKQIENYINEINKLKLTNKELEITNQKQLESSLKLQRNEFEEKINQQNLT
IEKLKIQQARSSIWAVAKKGNELEKWCENQYESYADSFENCQFTRYKTEI
NLLDENDFPNEKADYIFSFFGEKTNKIPFLSICCEMKSEFNDSKHKSKNK
DHISKLVRDAKRANCKYAFLISELELETENDIQVRLMPTLESGVEVYLVR
PMFFILMLKLFYKLAKKLFALNRFQSVELIDKNKLNEQFKQLKDNFLTKT
FLEIEKVCKSNLVDIETLEKAVVKLRVRNERVLDQLLNKWTKKIDSFDLQ
LTKKITNNY*
50
100
150
200
250
300
350
400
410
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3524C2183N572O648S12
Molecular weight (pH 7.5; Da) 48535.42 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
37650
Instability index 32.28
Is stable True
Aliphatic index 96.78
GRAVY (25C, pH 7.0) -0.588
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:50
Last updated 2012-10-01 15:14:30