MG_146_MONOMER – UPF0053 protein

Name
WID MG_146_MONOMER View in model
Name UPF0053 protein View in model
 
Genetics
Gene MG_146 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MDSAPSGLTLTVIILSIILLAFISTVVSAYETAITSLTPYRWKNYIKTNN
KQDKLSTKIINHFQNHYSSCLITILITNNIVAIMVSNILFLALEQTIKNE
LLSSVLNLVVSGVLIVSFCEILPKTLGRINVIRTLVLFAYLVYFFYLIFW
PITKLTSLILKKYENPLPVSRKDVYYFIDEIEQNGLFSKEDSLLIKKTLI
FDQVLVKKVMIKWKKVAYCYLNDSINLIAKQFLQRQFSRMPVVDKTTNKI
VGFIHLKDFFTAKEANPKSLDLNQLLYPVVLVQDSTPIKQALRQMRLNRA
HLAVVNDKHEKTIGIVSMEDIIEELVGEIYDEHDDIQPIQVLDENVWLVL
PNVKAAYFFNKWIKPDLVKSKNITIQHYLASLDNDSFACQNKLDTPLFSV
EVIADSEDKTKILYEIRKKSDVIA*
50
100
150
200
250
300
350
400
425
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 30 (nt) View in model
Empirical formula (pH 7.5) H3600C2254N553O623S10
Molecular weight (pH 7.5; Da) 48734.54 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
53330
Instability index 36.70
Is stable True
Aliphatic index 122.64
GRAVY (25C, pH 7.0) 0.190
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:07:50
Last updated 2012-10-01 15:14:30