MG_145_MONOMER – riboflavin biosynthesis protein RibF

Name
WID MG_145_MONOMER View in model
Name riboflavin biosynthesis protein RibF View in model
 
Genetics
Gene MG_145 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKSLFIGYFDGLHQGHLFLKQNSKFEPMVLLIDNPPLKQTNWLYDLQQRV
AQIKTYLKATVEVFDVAKHNMNALSFFEQQIKRLNCDEIIVGTDWHFGND
HKDGIWLKKLFKNTVIVNKTNLSSSVIRNYLTNNELEKANQLLVEPYYRV
GTVVHGLKKARLLGFPTANIVMDNHLLTLNKGSYIVRVLLNNQTFYGIGF
ISQKDQDLVCETHIFNFNNEIYGSLVKFTLLKFIRTISKFSSQAALQKAI
QSDANFALKWLENQNLDKI*
50
100
150
200
250
270
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2231C1426N375O393S6
Molecular weight (pH 7.5; Da) 31108.55 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
35660
Instability index 26.36
Is stable True
Aliphatic index 101.78
GRAVY (25C, pH 7.0) -0.166
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments First observed residue by mass-spec 75 [PUB_0280]. Functional Macromolecule Functional as monomer [PUB_0349, PUB_0350].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Karthikeyan S, Zhou Q, Mseeh F, Grishin NV, Osterman AL, Zhang H. Crystal structure of human riboflavin kinase reveals a beta barrel fold and a novel active site arch. Structure 11, 265-73 (2003). WholeCell: PUB_0350, PubMed: 12623014

  3. Mashhadi Z, Zhang H, Xu H, White RH. Identification and characterization of an archaeon-specific riboflavin kinase. J Bacteriol 190, 2615-8 (2008). WholeCell: PUB_0349, PubMed: 18245297

 
Metadata
Created 2012-10-01 15:07:50
Last updated 2012-10-01 15:14:30