MG_144_MONOMER

Name
WID MG_144_MONOMER View in model
 
Genetics
Gene MG_144 View in model
 
Structure
Sequence
1
51
101
151
201
251
MDPQNKSPKPQVKSTRLVVKKQPAGVVFPKLSIPVNDFEKTVTLTRAQKK
EAKLLKKAQRKANKLNNKQDSTFFNSASGETNNTILPPGVKNQADNKTNR
FSKFISFFTSSKNKQPDEITERLVDDPTVKNRFSAFNKKLIWVLKDKKLR
ARAWKIVGYTNLVIVAFFAGLLAVMNKFITLSSVEYPAIALQLPINNALW
GISIFVISIVTLPFWTMFILFLMGVKDVRTSRSIHYFIWIVLIINVVLLL
VSCLLMIAAYAHLDGYNIWRNLESLNPNN*
50
100
150
200
250
280
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2361C1466N384O387S6
Molecular weight (pH 7.5; Da) 31750.07 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
40575
Instability index 34.97
Is stable True
Aliphatic index 104.07
GRAVY (25C, pH 7.0) 0.00893
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29