MG_142_MONOMER – translation initiation factor IF-2

Name
WID MG_142_MONOMER View in model
Name translation initiation factor IF-2 View in model
Cross references PDB: 1ZO1
 
Genetics
Gene MG_142 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MKKNRAFNQVKKTKFDGRIKTSAKHQLRNVKTGVKDGVFIYKGPLTVSEF
ASKTNIAVANIIKHFFLNGLALTVNSVLTNEQLADACVNFGFDFKMETEV
THENIVANIQFEDSDDLLQPRPPIVTIMGHVDHGKTSLLDTIRKTNVTAK
EFGGITQKIGAYQVKNHQNKTITFIDTPGHEAFTLMRARGAKVTDIVVLV
VAADDGIKKQTEEAISHAKSANTPIIVFINKMDKPTANPDLVIQQLNKFD
LVPEAWGGKTIFVMGSALTGQGINELLDNILLLGEVEGYQANYNAHSSGY
AIEVQTSKGLGPIANVIVKRGTLKLGDIVVLGPAYGRVRTMHDENGNSLK
QATPSKPVQISGFDIMPVAGEKFIVFDDEKDAKLIANKFKEQQKQKANNL
TVNQTLKEQIKNKEIKILNLIFKADSDGSLQAIKQAVENINVAKISLSII
HAAVGQISESDIMLAKASGALLFSLNLGLSQTVKNIASLQGVKLEVHYHI
PKLAEEIENILKGQLDPVYEEIEIGKAEVLQLWFHSKIGNIAGTIVKSGK
IKRGNLCKLFRDKEIIFEGRIDSLKNEKTPVNLIETGKNCGIVINGCNDI
KIGDIIVAYEKQIVKDGKL*
50
100
150
200
250
300
350
400
450
500
550
600
620
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H4959C3042N825O900S13
Molecular weight (pH 7.5; Da) 67906.56 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24910
Instability index 29.43
Is stable True
Aliphatic index 102.84
GRAVY (25C, pH 7.0) -0.140
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0348]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Weber JA, Gay CV. Expression of translation initiation factor IF2 is regulated during osteoblast differentiation. J Cell Biochem 81, 700-14 (2001). WholeCell: PUB_0348, PubMed: 11329625

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29