MG_141_MONOMER – transcription termination factor NusA

Name
WID MG_141_MONOMER View in model
Name transcription termination factor NusA View in model
Cross references PDB: 1WCN
 
Genetics
Gene MG_141 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MKITFISGQEVSLGTSFLLFSKKIVMNELNQPLLAIIKNVAKTKNLSIEE
VVFCLKTALEQAYKKHLNFVNVEVNINFDKGIINVEQLFNVVSDENEDYD
DFLEIPLQAANKINSSLQLGDVLRKPIPLKNISSDLINKMIAIFNQKISE
TNFKAVMSEFSSEVGEVIEAKVEDIDTNKEGGLKGYIINLETTKGYISKR
ELSKGERLEIGKKYLFVIKEIQRQASLWPITLSRSDTRLLQFLLTSNTPE
IENGTIVIKKIERSPGVKSKIAVISNDPAVDPVAAILGPKGEKIRGISEE
FNGEIIDIVFWNEDKLKFLINAILPAEVIGYNILQDDERDTSIEVVVPAN
QIANVFGFKGVNIRLISNLTGWNSVDVYSEKDASEANIKFTRLSFEPEGL
FGIKKRREKIISNDATDKVFYTSKDNVIDDEIIVDLAKDLMVDNKQKQPE
QVAKQVVEKSQLEKQVTPKEKEKVQPKAKVHSNSHSKKPAKPNQIFSITV
DASDKNLKKDQVDNNQTNPQTKQTFDSFDDL*
50
100
150
200
250
300
350
400
450
500
532
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4325C2680N703O823S6
Molecular weight (pH 7.5; Da) 59754.45 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
28545
Instability index 36.05
Is stable True
Aliphatic index 100.17
GRAVY (25C, pH 7.0) -0.335
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0340].
References
  1. Gill SC, Yager TD, von Hippel PH. Escherichia coli sigma 70 and NusA proteins. II. Physical properties and self-association states. J Mol Biol 220, 325-33 (1991). WholeCell: PUB_0340, PubMed: 1856862

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29