MG_139_MONOMER – ribonuclease J

Name
WID MG_139_MONOMER View in model
Name ribonuclease J View in model
 
Genetics
Gene MG_139 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MIKDFNPGDFIGKKPTKIYAFGGIQEVGKNMYGIEYDDEIIIIDCGIKFA
SDDLLGINGIIPSFEHLIENQSKVKALFITHGHEDHIGGVPYLLKQVDIP
VIYAPRIAASLILKKVNEHKDAKLNKIVTFDDFSEFQTKHFKIDFYRVNH
SIPDAFGICVQTPNGNIVQSGDYRFDFAAGSEMLDVHKVVKIAERNVHVF
MSESTNAEVPGFSQSEKLIYRNIQKILKEARGRVILTTFASNITRINEII
EIALNNKRKICLLGKSMDVNVNISRKIGLMAIDSNDIVEVRDIKNYPDRN
ILILCTGSQGEEAAALNTMARGKHNWVSLKSTDTIIMSSNPIPGNYAAVE
NLLNELSKFGVAIYENSSQLKLHASGHATQQELQLMLNLMFPKYLIPIHG
EFKMMRTIKNIANECGIKSEDVALLSNGQVMYLIDEELYYSNEIINADPI
YIESHNSSPDLARIIKQRQILSRDGMFAVIVVFDKNNNIIGIPTLITRGC
FFALDSNPLMTKIAHSVKRTLESVIQSKKFNSHEQLTKELKRVCKETVSY
FIWKNKNRNPLISTVLSWI*
50
100
150
200
250
300
350
400
450
500
550
570
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4597C2884N773O838S22
Molecular weight (pH 7.5; Da) 64212.28 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
42705
Instability index 38.68
Is stable True
Aliphatic index 101.60
GRAVY (25C, pH 7.0) -0.121
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ribonuclease J
[c]: (2) MG_139_MONOMERMG_139_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0165]. Coenzymes Interacts with 2 ZN per monomer as prosthetic group [96].
References
  1. de la Sierra-Gallay IL, Zig L, Jamalli A, Putzer H. Structural insights into the dual activity of RNase J. Nat Struct Mol Biol 15, 206-12 (2008). WholeCell: PUB_0165, PubMed: 18204464

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29