MG_138_MONOMER – Translation elongation factor 4

Name
WID MG_138_MONOMER View in model
Name Translation elongation factor 4 View in model
Cross references PDB: 3CB4
 
Genetics
Gene MG_138 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MEQKNIRNFSIIAHIDHGKSTLSDRLLEHSLGFEKRLLQAQMLDTMEIER
ERGITIKLNAVELKINVDNNNYLFHLIDTPGHVDFTYEVSRSLAACEGVL
LLVDATQGIQAQTISNAYLALENNLEIIPVINKIDMDNADIETTKDSLHN
LLGVEKNSICLVSAKANLGIDQLIQTIIAKIPPPKGEINRPLKALLFDSY
YDPYKGVVCFIRVFDGCLKVNDKVRFIKSNSVYQIVELGVKTPFFEKRDQ
LQAGDVGWFSAGIKKLRDVGVGDTIVSFDDQFTKPLAGYKKILPMIYCGL
YPVDNSDYQNLKLAMEKIIISDAALEYEYETSQALGFGVRCGFLGLLHMD
VIKERLEREYNLKLISAPPSVVYKVLLTNGKEISIDNPSLLPERSKIKAI
SEPFVKVFIDLPDQYLGSVIDLCQNFRGQYESLNEIDINRKRICYLMPLG
EIIYSFFDKLKSISKGYASLNYEFYNYQHSQLEKVEIMLNKQKIDALSFI
SHKDFAFKRAKKFCTKLKELIPKHLFEIPIQATIGSKVIARETIKAVRKD
VIAKLYGGDVSRKKKLLEKQKEGKKRLKAVGSVQLPQELFSHLLKDED*
50
100
150
200
250
300
350
400
450
500
550
599
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4937C3081N802O885S18
Molecular weight (pH 7.5; Da) 67950.98 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
42385
Instability index 24.09
Is stable True
Aliphatic index 105.94
GRAVY (25C, pH 7.0) -0.157
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0220].
References
  1. Evans RN, Blaha G, Bailey S, Steitz TA. The structure of LepA, the ribosomal back translocase. Proc Natl Acad Sci U S A 105, 4673-8 (2008). WholeCell: PUB_0220, PubMed: 18362332

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29