MG_137_MONOMER – UDP-galactopyranose mutase

Name
WID MG_137_MONOMER View in model
Name UDP-galactopyranose mutase View in model
Cross references PDB: 1I8T
 
Genetics
Gene MG_137 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
VNVILSVMLFSSPSCVNINSFDILIVGAGISGIVLANILANHNKRVLIVE
KRDHIGGNCYDKVDSKTQLLFHQYGPHIFHTNNQTVINFISPFFELNNYH
HRVGLKLKNNLDLTLPFDFQQIYKLMGKDGRKLVSFFKENFSLNTHLSLA
ELQLIDNPLAQKLYQFLISNVYKPYSVKMWGLPFAMINENVINRVKIVLS
EQSSYFPDAIIQGLPKSGYTNSFLKMLANPLIDVQLNCKDNLLVYQDEKL
FFNNNLIEKPVVYCGLIDKLFNFCFGHLQYRSLAFSWKRFNQKKYQTYPV
VNMPLAKSITRSVEYKQLTNQGSFKPQTIVSFETPGSYAINDPRFNEPYY
PINNTLNDTLFKKYWKKASKLKNLHLLGRLATYQYIDMDKAILLSIKKAQ
QLLS*
50
100
150
200
250
300
350
400
405
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3352C2152N551O583S12
Molecular weight (pH 7.5; Da) 46655.63 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48415
Instability index 28.69
Is stable True
Aliphatic index 100.57
GRAVY (25C, pH 7.0) -0.123
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit UDP-galactopyranose mutase
[c]: (2) MG_137_MONOMERMG_137_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with FAD with unknown stoichiometry as coenzyme [96].
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29