MG_136_MONOMER – lysyl-tRNA synthetase

Name
WID MG_136_MONOMER View in model
Name lysyl-tRNA synthetase View in model
Cross references PDB: 1BBW, PDB: 1KRT
 
Genetics
Gene MG_136 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MSDRLNDQAQHRLQKLLRLKQTNNDPYLVTKTSLTHSSKSFQVEFEKCSE
EELKKKATVSLAGRIIAIRQTFLIIQDFDGQVQLYINKKIHPKLFDYFNE
FVDIGDQIVVSGKPMLTKTKVLTLAVEEMKIIAKCLLVPPEKWHGLTDIE
TRARKRFLDLTYNLAMRDVFLKRTKIIKSIRSFLDQNGFIEVETPTLQAV
LGGANAKPFKTHYNALKADFYLRIANEIALKKLIIGGFNKVYEMGKMFRN
EGVDTTHNPEFTSIEIYQAYADFEVMLVLVEKLIQSLCESLNQFSFNWNN
KTINLKTPFHKITMVELIKKVTGIDFNSVKDDQSAILLAEKHHVKLAKHQ
QNKQHIINLFFEQFCEQTLIEPTFVTHYPKAVSPLAKQDPSNPEFTQRFE
LFINGKEIANAYSELNDPLEQRKRFEQQLEEKQLGNDETSELDESFLEAL
SFGMVNTAGLGIGIDRLVMLLCECNSIRDVVFFPQLREHK*
50
100
150
200
250
300
350
400
450
491
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4051C2559N676O736S16
Molecular weight (pH 7.5; Da) 56575.51 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
28140
Instability index 38.90
Is stable True
Aliphatic index 94.11
GRAVY (25C, pH 7.0) -0.296
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit lysyl-tRNA synthetase
[c]: (2) MG_136_MONOMERMG_136_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 3 MG per monomer as prosthetic group [96]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29