MG_134_MONOMER

Name
WID MG_134_MONOMER View in model
 
Genetics
Gene MG_134 View in model
 
Structure
Sequence
1
51
101
MSFKKIAEMMRQAERETKKKTLAFEQQAFEYNYKNGAIKITILGDLTLKS
INIDPVLIDASDKVILEEMIIEATNEAVSDVKTKYDNLVEKTMPKVPGLF
*
50
100
101
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H832C511N127O155S5
Molecular weight (pH 7.5; Da) 11395.12 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
4470
Instability index 33.62
Is stable True
Aliphatic index 94.65
GRAVY (25C, pH 7.0) -0.257
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29