MG_132_MONOMER – purine nucleoside phosphoramidase

Name
WID MG_132_MONOMER View in model
Name purine nucleoside phosphoramidase View in model
 
Genetics
Gene MG_132 View in model
 
Structure
Sequence
1
51
101
MEKNTTSSCIFCDIVQGSITSYKIGENEHAIAFLDAFPVADGHTLVIPKK
HAVDFSSTDQKELQAVSLLAKQIALKLKMTLKPSGLNYVSNEGAIAGQVV
FHFHLHIVPKYETGKGFGYNVNKTNKRSLEENYQLISESKN*
50
100
142
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1102C700N185O210S4
Molecular weight (pH 7.5; Da) 15597.57 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7700
Instability index 29.40
Is stable True
Aliphatic index 87.89
GRAVY (25C, pH 7.0) -0.229
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit purine nucleoside phosphoramidase
[c]: (2) MG_132_MONOMERMG_132_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0115].
References
  1. Brenner C, Bieganowski P, Pace HC, Huebner K. The histidine triad superfamily of nucleotide-binding proteins. J Cell Physiol 181, 179-87 (1999). WholeCell: PUB_0115, PubMed: 10497298

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29