MG_131_MONOMER – hypothetical protein

Name
WID MG_131_MONOMER View in model
Name hypothetical protein View in model
 
Genetics
Gene MG_131 View in model
 
Structure
Sequence
1
51
MQYSALIPLFILLISLVLFCFSFRKNQSENQIVKILFFAYCIDFLALILA
VMLLTFLSHGLLSLAILIPVLVFQ**CFLLWLLVTIPLWKDYLEI
50
95
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H823C533N109O118S5
Molecular weight (pH 7.5; Da) 10806.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
15845
Instability index 27.03
Is stable True
Aliphatic index 167.26
GRAVY (25C, pH 7.0) 1.50
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:29