MG_130_MONOMER

Name
WID MG_130_MONOMER View in model
 
Genetics
Gene MG_130 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MNNNITNSIAQLFFNTSFFAFLFLIIIAFNLCLFAYLYFQYRIYKKNPKK
ANNFKANEYEKIKLLKNQNFTESNKLIATTNELNELTSQLDNILVRIINK
PLAKLVNDFLDEQIKQIVKLDKNSSDFHSESDNLPFYTKLFNDFHFGVDK
LININIKNPLYNWVYSPSFLISESDFRKLNGISGINKKLLVEKLRIEDIV
FTDLNKKYEVNVLTESPIKAQKTVLTVRNILMNDYVDNERIESYVQQANF
FFTEHCKKIGKEILESLNIFISSSSLHRHFGFLAFRYSFGQNVLSHSLET
AFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGKESHTITGAKLAEQF
QLPDDIKYTIANHHNKHIDNTYCRLTQIADKLSAARIGARSDSSLLFKQL
KDELKKIVDKTINNFHTTILLGQSGRRLMIWLETKNQNQLLSNEQIIEMV
EKIKAEIAKNPITNHFPIKVVIRYNFEHSFNTKS*
50
100
150
200
250
300
350
400
450
485
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4008C2550N671O733S8
Molecular weight (pH 7.5; Da) 56049.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
33850
Instability index 27.59
Is stable True
Aliphatic index 100.14
GRAVY (25C, pH 7.0) -0.269
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0384].
References
  1. Yoko I, Koki H. The role of the delta peptide of the Bacillus subtilis RNA polymerase in promoter selection. Agric. Biol. Chem 54, 3205-9 (1990). WholeCell: PUB_0384, None

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:28