MG_129_MONOMER – Putative phosphotransferase enzyme glucose-specific IIB component

Name
WID MG_129_MONOMER View in model
Name Putative phosphotransferase enzyme glucose-specific IIB component View in model
 
Genetics
Gene MG_129 View in model
 
Structure
Sequence
1
51
101
MKWLLWLGYIFSFGLLYLWIVKKSKQIAQQPNTKLVESTSIPFKVKDFVS
ACGGKENFVNIKTTPTQLIVTFKDVNSVSLTKLNALNIKGINKNQNQFRF
VLGNFVNELKKKIEDEQ*
50
100
118
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 23 (nt) View in model
Empirical formula (pH 7.5) H998C626N157O168S2
Molecular weight (pH 7.5; Da) 13475.66 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19605
Instability index 26.19
Is stable True
Aliphatic index 99.83
GRAVY (25C, pH 7.0) -0.119
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:28