MG_128_MONOMER – inorganic polyphosphate/ATP-NAD kinase, probable

Name
WID MG_128_MONOMER View in model
Name inorganic polyphosphate/ATP-NAD kinase, probable View in model
 
Genetics
Gene MG_128 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKYKIFASTTPQTEPVLNKLRAVLKTWQAVENGYEYVFVLGGDGFFVSTL
ANYNCDSCKVVGINTGHIGFYTSFNGDDLDENFISKLTSFEFKKINLLEV
KTKNHSFLVLNELAVYTNTAYPINIFIDDNHWESYRGSGLLIGPRTGSTA
LAKSAKGAVIFPNVDVVQIIELNPLLHPNQITIQSPIILPMQTKVEFRIK
KAFKAEQFPNFYADGIKLDLKNEDTSISFQLVLSRSMFHASLKTKDFIDK
LKSTFIKQS*
50
100
150
200
250
260
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2083C1342N336O383S5
Molecular weight (pH 7.5; Da) 29212.16 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24660
Instability index 21.68
Is stable True
Aliphatic index 93.35
GRAVY (25C, pH 7.0) -0.0781
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit inorganic polyphosphate/ATP-NAD kinase, probable
[c]: (6) MG_128_MONOMERMG_128_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [96,386].
 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:28