MG_127_MONOMER – Spx subfamily protein

Name
WID MG_127_MONOMER View in model
Name Spx subfamily protein View in model
 
Genetics
Gene MG_127 View in model
 
Structure
Sequence
1
51
101
MKKAGKKNSDAGKTFILISSSCSSCQKAIEFFDQNKISYVVENFYKKPIS
DKRFKDILSLSEDGTESLFSKRADQIKATNSVSVEELSISELIKLVRERP
SLLRRPIIIQYNSSGIPKRMRIGYNSSEIKVFERKLIEPKPIIQQ*
50
100
146
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_127_MONOMER_ox: 22-25 View in model
DNA footprint Length: 25 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H1222C739N202O220S4
Molecular weight (pH 7.5; Da) 16585.04 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6210
Instability index 51.12
Is stable False
Aliphatic index 90.14
GRAVY (25C, pH 7.0) -0.454
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Regulation
Regulatory rule stimulus_thiolStress View in model
 
Function
Transcriptional regulation View in model
Reaction participant View in model
Complex subunit oxidized Spx subfamily protein
[c]: MG_127_MONOMER ⇒ (2) H + MG_127_MONOMER_ox
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0112]. Transcriptional Regulation Affects transcription by interacting solely with RNA polymerase, and does not directly bind DNA [PUB_0434]. Together with RNAP spx has 43-50 nt footprint [PUB_0728]. RNAP and RNAPα alone have footprints of 7 and 25 nt [PUB_0728]. We conclude that spx alone has a footprint of 25 nt [PUB_0728]. Regulation Activated by thiol stress [PUB_0434, PUB_0435, PUB_0436].
References
  1. Choi SY, Reyes D, Leelakriangsak M, Zuber P. The global regulator Spx functions in the control of organosulfur metabolism in Bacillus subtilis. J Bacteriol 188, 5741-51 (2006). WholeCell: PUB_0436, PubMed: 16885442

  2. Erwin KN, Nakano S, Zuber P. Sulfate-dependent repression of genes that function in organosulfur metabolism in Bacillus subtilis requires Spx. J Bacteriol 187, 4042-9 (2005). WholeCell: PUB_0435, PubMed: 15937167

  3. Nakano S, Erwin KN, Ralle M, Zuber P. Redox-sensitive transcriptional control by a thiol/disulphide switch in the global regulator, Spx. Mol Microbiol 55, 498-510 (2005). WholeCell: PUB_0728, PubMed: 15659166

  4. Nakano S, Küster-Schöck E, Grossman AD, Zuber P. Spx-dependent global transcriptional control is induced by thiol-specific oxidative stress in Bacillus subtilis. Proc Natl Acad Sci U S A 100, 13603-8 (2003). WholeCell: PUB_0434, PubMed: 14597697

  5. Newberry KJ, Nakano S, Zuber P, Brennan RG. Crystal structure of the Bacillus subtilis anti-alpha, global transcriptional regulator, Spx, in complex with the alpha C-terminal domain of RNA polymerase. Proc Natl Acad Sci U S A 102, 15839-44 (2005). WholeCell: PUB_0112, PubMed: 16249335

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:28