MG_126_MONOMER – tryptophanyl-tRNA synthetase

Name
WID MG_126_MONOMER View in model
Name tryptophanyl-tRNA synthetase View in model
 
Genetics
Gene MG_126 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MIKRAITGIQASGRQHLGNFLGVMQGLKQLQSQYQLFLFVADLHAITVDF
EPTMLKDNNLQLVKTLLALGLDYGKVNLFLQSDLMEHTMLGYLMLTQSNL
GELQRMTQFKTKKLAQKRNSNNTITIPTGLLTYPVLMAADILLYQPDIVP
VGNDQKQHLELTNDLAKRVAKKFKLKLKLPVFIENKDTNRIMDLSNPLKK
MSKSNPDQNGVIYLDDSKETIIKKVRKATTDSFNKIRFAKKTQPGVTNLL
VILTALLKEEVNHNLSKKIGSDLVKYYQNKSYLDLKNDLSSAVINVIESL
KFKKAQITDEMVLKVLNDGKNQAKKVADETLKMFYKAFGLTSNQLFD*
50
100
150
200
250
300
348
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H2917C1771N470O511S12
Molecular weight (pH 7.5; Da) 39354.62 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14900
Instability index 25.41
Is stable True
Aliphatic index 103.36
GRAVY (25C, pH 7.0) -0.258
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit tryptophanyl-tRNA synthetase
[c]: (2) MG_126_MONOMERMG_126_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:49
Last updated 2012-10-01 15:14:28