MG_124_MONOMER – thioredoxin

Name
WID MG_124_MONOMER View in model
Name thioredoxin View in model
Cross references PDB: 1TKD, PDB: 2TRX
 
Genetics
Gene MG_124 View in model
 
Structure
Sequence
1
51
101
MVTEIRSLKQLEEIFSAKKNVIVDFWAAWCGPCKLTSPEFQKAADEFSDA
QFVKVNVDDHTDIAAAYNITSLPTIVVFENGVEKKRAIGFMPKTKIIDLF
NN*
50
100
103
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_124_MONOMER_ox: 30-33 View in model
Empirical formula (pH 7.5) H811C524N131O152S4
Molecular weight (pH 7.5; Da) 11506.06 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12740
Instability index 29.03
Is stable True
Aliphatic index 88.06
GRAVY (25C, pH 7.0) -0.0398
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Reaction participant View in model
Complex subunit oxidized thioredoxin
[c]: MG_124_MONOMER ⇒ (2) H + MG_124_MONOMER_ox
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0346, PUB_0347].
References
  1. Das M, Kobayashi M, Yamada Y, Sreeramulu S, Ramakrishnan C, Wakatsuki S, Kato R, Varadarajan R. Design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts. J Mol Biol 372, 1278-92 (2007). WholeCell: PUB_0347, PubMed: 17727880

  2. Gronenborn AM, Clore GM, Louis JM, Wingfield PT. Is human thioredoxin monomeric or dimeric?. Protein Sci 8, 426-9 (1999). WholeCell: PUB_0346, PubMed: 10048336

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:28