MG_123_MONOMER – arginine deaminasse

Name
WID MG_123_MONOMER View in model
Name arginine deaminasse View in model
 
Genetics
Gene MG_123 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MLLNLNNNSVLIVAFVIVSLFFLIIVGFALNLAIAFSLHLKQNKNNKKYI
LNDQQIQLRLTEKQAQLTTLLNFYQQKIESVNREKSWLESQLQVIDKKDL
KQAQKLTLHLKKDQILAQLNEKLIQKKVDQPLVNELQKTKLSYLERLVDQ
KIKLSENNFKSAFLKTKVKETAFNIFAAKNKVNWEYFKQVCDADCTLKNL
EDEVEITFSNWSYLRRMQALLAFEKLISKIKTVKINELVINETLDEVKNE
ISQTAFQAGEKIVKEFQITNLNEQITRLIGLQKYYFGTDQLNLLELAVLT
TKLVILLNKKFKLDLDLELLKAASLFNYLKWVDNNQFFQILNTKLNQLLI
SDQVIAIIQQQELSFYPDQYGMLINGVKTMIREHNTIDFEKLVFLNSTKL
IDNFYLYDLNMIHAVEYNNCFYYFVSVKPFEIKSLAELDLFVVLLKTFLA
KKQKQNPKAVKLFITTKILAI*
50
100
150
200
250
300
350
400
450
472
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4090C2545N635O704S8
Molecular weight (pH 7.5; Da) 55103.89 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
44725
Instability index 22.72
Is stable True
Aliphatic index 118.75
GRAVY (25C, pH 7.0) -0.0521
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit arginine deaminase
[m]: (2) MG_123_MONOMERMG_123_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0096].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:28