MG_122_MONOMER – DNA topoisomerase I

Name
WID MG_122_MONOMER View in model
Name DNA topoisomerase I View in model
Cross references PDB: 1YUA
 
Genetics
Gene MG_122 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
MIKNLVVIESPNKVKTLKQYLPSDEFEIVSTVGHIREMVYKNFGFDENTY
TPIWEDWTKNKQKNPKQKHLLSKFEIIKSIKAKASDAQNIFLASDPDREG
EAISWHVYDLLDQKDKAKCKRITFNEITKKAVVDALKQPRNIDLNWVESQ
FARQILDRMIGFRLSRLLNSYLQAKSAGRVQSVALRFLEEREKEIAKFVP
RFWWTVDVLLNKENNQKVVCANKSIPLVLREINPELSASLKLDFEAAENV
SGIDFLNEASATRFANQLTGEYEVYFIDEPKIYYSSPNPVYTTASLQKDA
INKLGWSSKKVTMVAQRLYEGISVNGKQTALISYPRTDSIRISNQFQSEC
EKYIEKEFGSHYLADKNKLKRHKKDEKIIQDAHEGIHPTYITITPNDLKN
GVKRDEFLLYRLIWIRTVASLMADAKTSRTIVRFINQKNKFYTSSKSLLF
DGYQRLYEEIKPNTKDELYIDLSKLKIGDKFSFEKISVNEHKTNPPPRYT
QASLIEELEKSNIGRPSTYNTMASVNLERGYANLVNRFFYITELGEKVNN
ELSKHFGNVINKEFTKKMEKSLDEIAENKVNYQEFLKQFWTNFKSDVKLA
ENSIQKVKKEKELVERDCPKCNQPLVYRYTKRGNEKFVGCSDFPKCKYSE
FSNPKPKLTLETLDELCPECNNKLVKRRTKFNAKKTFIGCSNFPNCRFIK
KDNAAEFKQ*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
710
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 19 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H5886C3717N1002O1087S18
Molecular weight (pH 7.5; Da) 82579.50 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
92595
Instability index 31.29
Is stable True
Aliphatic index 79.92
GRAVY (25C, pH 7.0) -0.645
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme Positive supercoiling (topoisomerase I)
View in model
Reaction participant View in model
 
Parameters
Parameters View in model
 
Comments
Comments first observed N-terminal residue by mass-spec 3 [PUB_0280] Functional Macromolecule Functional as monomer [PUB_0096]. DNA-binding Topoisomerase I has 15-19 nt footprint [PUB_0693].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

  3. Wang JC. DNA topoisomerases. Annu Rev Biochem 65, 635-92 (1996). WholeCell: PUB_0693, PubMed: 8811192

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:28