MG_120_MONOMER – Monosaccharide (riboside/galactoside) ABC transporter, permease protein

Name
WID MG_120_MONOMER View in model
Name Monosaccharide (riboside/galactoside) ABC transporter, permease protein View in model
Cross references PDB: 1URP, PDB: 2GX6
 
Genetics
Gene MG_120 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MTMWQFKSYFKHHLVFWKDRFLHSSEKQMQRRSILSSVVLIILSFLISFL
LIISIPGGRGASFFALFTKLFLDNTNTENFLRQIAIYILAGLAFSFCMSV
GIFNIGISGQMMAGAIFGFLMILKVFPSSFRPGFGGQIITVLLMVIGSVS
VAVVVATLKIFFKVNEVVSAIMLNWIVVLISAYLVETYIKDNSGGTAQFF
SLPLPDEFALYNFSPLTKKFGWLASLIIAFISVIIVAVVLKYTVFGHKLK
SIGSSVFGSQAMGFNVRKYQFLSFIISGILSGLLATVVYTASTEKVLTFN
NVGDSAISAVPATGFDGIAIGLIALNNPFRIVIVSVLIAFVNIGARPANL
NPNTASLVLGIMMYFAALYNLMVYFKPWRYLVKLNIGKINLTTYETYENK
LAANLEWLSFQRFLSKQKKKNDKTKFNWFDTSLFEQYAKNKQEIVQEYHH
NCATNLIAWWLNAIQSGNIKPSTTFKLEFVNFKHQQKFVLNWFKNESESL
RDFQSQFERINKLVEREFVK*
50
100
150
200
250
300
350
400
450
500
521
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4285C2770N673O711S15
Molecular weight (pH 7.5; Da) 58871.55 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
79090
Instability index 26.07
Is stable True
Aliphatic index 108.89
GRAVY (25C, pH 7.0) 0.451
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit Monosaccharide (riboside/galactoside) ABC transporter
MG_040_MONOMER[e] + (2) MG_119_MONOMER[c] + MG_120_MONOMER[m] + MG_121_MONOMER[m] ⇒ MG_040_119_120_121_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_040_119_120_121_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:28