MG_119_MONOMER – Monosaccharide (riboside/galactoside) ABC transporter, ATP-binding protein

Name
WID MG_119_MONOMER View in model
Name Monosaccharide (riboside/galactoside) ABC transporter, ATP-binding protein View in model
 
Genetics
Gene MG_119 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MEKVAFKMEHISKSFDNGKIKANVDVSLVVYENTVHTILGENGAGKSTLT
SILFGLYKPDSGKIFIGEKQVNFKSSKDAVKHKIGMVHQHFKLIENYTVL
DNIILGNESRFGFLPLINRKVSEAKIKTIMEKYGIFVDLKQKVSNLTVGQ
QQRVEILKVLFRDSNILIFDEPTAVLSDLEIQNFLKIIANFKKLGKTIVL
ISHKLNEIKQVADTATVLRLGKVVGSFDVKTTPVDKIALLMMGKELKQTK
NTTDFVAKDEPVLKVQNLNLFLNKSLAYKFLVRCNNIHKAQQIKKNKPLK
DLWIISFLNKLTTSNKTPKLVKGLINKLGLSYQENTDETISFAIHKGEIF
AIAGVEGNGQSQLVNLICGIEKAASNKLIFNNIDISRWSIRKRINAGISF
VLEDRHKYGLILDQTVRFNTVNNQINNRPFSSWNFLKPMEIALYSNTIIK
KFDVRGSAEGSAVVRRLSGGNQQKLIIGREMTKQNDLLVLAQVTRGLDIG
AIAFIHENILLAKANNKAILLVSYELDEILALADTVAVINKGRIVGMGKR
DLMDRQSIGRLIMQ*
50
100
150
200
250
300
350
400
450
500
550
565
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4711C2859N778O807S13
Molecular weight (pH 7.5; Da) 63312.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30160
Instability index 27.07
Is stable True
Aliphatic index 111.08
GRAVY (25C, pH 7.0) -0.0612
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit Monosaccharide (riboside/galactoside) ABC transporter
MG_040_MONOMER[e] + (2) MG_119_MONOMER[c] + MG_120_MONOMER[m] + MG_121_MONOMER[m] ⇒ MG_040_119_120_121_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_040_119_120_121_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:28