MG_115_MONOMER – competence/damage-inducible protein CinA domain protein

Name
WID MG_115_MONOMER View in model
Name competence/damage-inducible protein CinA domain protein View in model
 
Genetics
Gene MG_115 View in model
 
Structure
Sequence
1
51
101
151
LFANLIAEKLQKLQLSVATAESVTGGLLAHCLTSIDGASNYFNGGVIAYN
NQVKINLLNVQSSTIANHGAVSSFCAREMAVGVKQKFQADVGIACSGIAG
SKAVENKAIGLLFFCIIIGNKAYDFEFEMNQNNRKDNIELFTNKILESFH
YLLTKLA*
50
100
150
158
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1207C761N202O225S6
Molecular weight (pH 7.5; Da) 16978.29 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6460
Instability index 31.63
Is stable True
Aliphatic index 103.80
GRAVY (25C, pH 7.0) 0.227
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27