MG_113_MONOMER – asparaginyl-tRNA synthetase

Name
WID MG_113_MONOMER View in model
Name asparaginyl-tRNA synthetase View in model
 
Genetics
Gene MG_113 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MKSVTVKQLLQTPRKFNNKQIKLSGWVKNKRASANIIFLAISDGSSINTL
QAVVKQEDNPQVFSLLQTVNLASAVMVWGEIILTPKAKQPLELKLKQVSL
LAQAESDYPLQKKEHSQEFFRSNAHLRVRAKTYFAVMKIRSVLSHAIFEY
FFKNDFILVQSPILTSNDCEGAGETFVIKDSETFFNKTTFLTVSGQFGAE
AFAQAFKKVFTFGPTFRAEKSHTNRHLSEFWMIEPEIAFANLKDLMQLIQ
NLIKFLIKKVMENASDELNVLAKQFSNDIISNLKTIISTKKFPIIEYSKA
LAILKESSDTKKTNFELNDFSFGIDLKTEHERFLCEQYFQNQPLFVINYP
KELKAFYMKTNTDNKTVAAVDLLLPKIGEICGGSERESDLNQLKNRCQSL
NIDTKSLNWYLDMRKWGYFASAGFGLGFDRLLAYICGLENIRDAIPFPRV
HGTINF*
50
100
150
200
250
300
350
400
450
457
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H3731C2377N616O672S13
Molecular weight (pH 7.5; Da) 52106.48 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
43025
Instability index 33.90
Is stable True
Aliphatic index 90.72
GRAVY (25C, pH 7.0) -0.180
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit asparaginyl-tRNA synthetase
[c]: (2) MG_113_MONOMERMG_113_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27