MG_112_MONOMER – ribulose-phosphate 3-epimerase

Name
WID MG_112_MONOMER View in model
Name ribulose-phosphate 3-epimerase View in model
 
Genetics
Gene MG_112 View in model
 
Structure
Sequence
1
51
101
151
201
VATKVVFSLLPLLNRFDKSLLESYFQDGLRLIHYDVMDQFVHNTAFKGEY
LDELKTIGFDVNVHLMVEQIIPQINFYLSQPNVKRISFHVEPFSFAKIKE
LIQLVKENGKEVGLAFKFTTNLQLYQPFFTTIDFITLMSVPPGKGGQAFN
EAVFTNLKIANHYNLKIEIDGGIKVNNIDQIKAFVDFIVMGSGFIKLEQW
QRQKLLQTI*
50
100
150
200
210
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1734C1123N276O303S4
Molecular weight (pH 7.5; Da) 24077.64 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14440
Instability index 31.20
Is stable True
Aliphatic index 105.29
GRAVY (25C, pH 7.0) 0.0757
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ribulose-phosphate 3-epimerase
[c]: (2) MG_112_MONOMERMG_112_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27