MG_111_MONOMER – glucose-6-phosphate isomerase

Name
WID MG_111_MONOMER View in model
Name glucose-6-phosphate isomerase View in model
 
Genetics
Gene MG_111 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
VFMSDKLLTIDLSHVYGFDKEIIFKKYQKKVDQIHQDFLAHKLADGHMTG
WYDQPDQNHQFLLKTINQIDKKFKSLKVTDIVYVGIGGSFTGIKTVLDFL
KPKQRTGLKIHFVPDLSAFQAASVIKEIKNKSWALITTSKSGRTLEPALN
FRIFRNLLNKRYGNKHYQRVVVITDEKKGLLTKMASNHGYQKLVIDSNIG
GRFSTLSPAGLLLAKLFGHDPKAILKGTLQAKKDLQTTSLENNSAYLYAV
VRHWLYTTKKFKIEVCIAYHSLYEYLLLQHRQLFGESEGKNDKSLFPTFS
IFTVDLHSMGQLYQEGEKVFFETVIDVKNPLVNINLPPSDFDNDDELDFL
LDKSLNEISDVAIDSVIKAHYQANVSIIKLTLKEQSAFMFGYFYFWLSVA
TVMSGSLLGHNVFNQPGVEVYKKLMFEKLRSGH*
50
100
150
200
250
300
350
400
434
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H3555C2279N584O633S8
Molecular weight (pH 7.5; Da) 49519.52 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48945
Instability index 27.59
Is stable True
Aliphatic index 95.88
GRAVY (25C, pH 7.0) -0.190
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit glucose-6-phosphate isomerase
[c]: (2) MG_111_MONOMERMG_111_DIMER
View in model
 
Comments
Comments First observed residue by mass-spec 1 [PUB_0280]. Functional Macromolecule Functional as homodimer. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27