MG_110_MONOMER – ribosome small subunit-dependent GTPase A

Name
WID MG_110_MONOMER View in model
Name ribosome small subunit-dependent GTPase A View in model
 
Genetics
Gene MG_110 View in model
 
Structure
Sequence
1
51
101
151
201
251
MPDSNFGIVLQSLAKQCKVFWNNQIITAFPQKKLQWKNDFKLMVGDRVQL
EDGAITKVLARKNELTRPRVANVDQIVLIQSLVQPKINWIQLLKLLVYFN
AKLIDEIPILITKTDLDFDPMEKQKLIDLKQFNYQLFFVSKNEPLPSELI
DIFSKKLSVFTGQSGVGKSSLINRLDPSLKQKIQALSVNKFGKNTTTKTT
LFSFRGGFICDTPGFNVISIKNLKILAAQHFVGFQKMISKCHFSNCYHQY
EKDCFVTTSVMKNRYPSWLYEKYRKMIN*
50
100
150
200
250
279
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2355C1476N381O399S11
Molecular weight (pH 7.5; Da) 32174.43 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
33055
Instability index 24.01
Is stable True
Aliphatic index 96.02
GRAVY (25C, pH 7.0) -0.167
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Parameters
Parameters View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0096]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27