MG_109_MONOMER – serine/threonine protein kinase, putative

Name
WID MG_109_MONOMER View in model
Name serine/threonine protein kinase, putative View in model
 
Genetics
Gene MG_109 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MEAILKIGDIVENKYQIEKLLNRGGMDSYLFLAKNLNLKNYGPVQKKQYG
HLVLKVVQKNPKINENNWKKFLDEMVTTTRVHHSNLVKSFDVVNPFLKIV
RGNKTIALNQIVMIAMEYVDGPSLRQLLNRKGYFSVSEVVYYFTKIVKAI
DYLHSFKHQIIHRDLKPENILFTSDLTDIKLLDFGIASTVVKVAEKTEVL
TDENSLFGTVSYMIPDVLESTVNKAGKKVRKPPNAQYDIYSLGIILFEML
VGRVPFNKSINPNKERETIQKARNFDLPLMQATRSDIPNSLENIAFRCTA
VKRENNKWLYSSTKELLEDLANWENEQAMIKPANERVLEGQVEIREMMLE
KPLAWYFKTWALSIFTIVFIGLIIAAIVLLLIFNARF*
50
100
150
200
250
300
350
388
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3258C2041N530O565S12
Molecular weight (pH 7.5; Da) 44645.57 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48485
Instability index 21.68
Is stable True
Aliphatic index 105.72
GRAVY (25C, pH 7.0) -0.113
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit serine/threonine protein kinase, putative
[m]: (2) MG_109_MONOMERMG_109_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0310, PUB_0311].
References
  1. Greenstein AE, Echols N, Lombana TN, King DS, Alber T. Allosteric activation by dimerization of the PknD receptor Ser/Thr protein kinase from Mycobacterium tuberculosis. J Biol Chem 282, 11427-35 (2007). WholeCell: PUB_0311, PubMed: 17242402

  2. Gruszczyski P, Kamierkiewicz R, Obuchowski M, Lammek B. Theoretical Modeling of PrkCc, Serine–Threonine Protein Kinase Intracellular Domain, Complexed with ATP Derivatives. QSAR & Combinatorial Science 27, 437-44 (2007). WholeCell: PUB_0310, URL: http://onlinelibrary.wiley.com/doi/10.1002/qsar.200730081/abstract

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27