MG_108_MONOMER – Ser/Thr protein phosphatase 2C, putative

Name
WID MG_108_MONOMER View in model
Name Ser/Thr protein phosphatase 2C, putative View in model
 
Genetics
Gene MG_108 View in model
 
Structure
Sequence
1
51
101
151
201
251
MQAANDHFFTGLSKKGPVRKENQDFYGFSFNQNNLLIVVCDGLGGYKGGK
IASNLVGKLFLSLFEGFEFNQWDETTVKKWFENTLIQARFQLENCFQTVY
EAQIQFARMASTLVLGILTKSDIYIFWIGDSRAYLLFENQAKLVTKDHNL
YNQLVAMNADEKLLLSYSNQLLALTNTISKETKRPLVYGFYNTKIEQQEF
LLLCSDGLYNFVEKELFFEIITNSKNLKQAVFNLYRKSIENASNDNITAA
LVNLQKWKQS*
50
100
150
200
250
261
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2105C1372N348O394S6
Molecular weight (pH 7.5; Da) 29970.80 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
38765
Instability index 20.29
Is stable True
Aliphatic index 92.30
GRAVY (25C, pH 7.0) -0.194
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0329, PUB_0330].
References
  1. Cohen P. The structure and regulation of protein phosphatases. Annu Rev Biochem 58, 453-508 (1989). WholeCell: PUB_0329, PubMed: 2549856

  2. McGowan CH, Cohen P. Identification of two isoenzymes of protein phosphatase 2C in both rabbit skeletal muscle and liver. Eur J Biochem 166, 713-21 (1987). WholeCell: PUB_0330, PubMed: 3038550

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27