MG_105_MONOMER – putative DNA integrity scanning protein

Name
WID MG_105_MONOMER View in model
Name putative DNA integrity scanning protein View in model
 
Genetics
Gene MG_105 View in model
 
Structure
Sequence
1
51
101
151
201
MVVNILLFITLIFLLLLFVFLIAFAFLNKRVRNYVVRTWTSVFSKSKQNL
DKKNFFDNLTSTLLRLSVDKIGAIIAIEKRDSLDPYINIGYRVSSDFSPE
LLVTIFYNKSSPLHDGAVIVRDYKIISVSSYFPMTRQLIDVSYGSRHRSA
LGLSEKSDAVVFIVSETTGKISVALKGVIKTLSSNSDRLQDEIIHYLSSK
*
50
100
150
200
201
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1674C1044N266O291S2
Molecular weight (pH 7.5; Da) 22672.13 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
17420
Instability index 40.98
Is stable False
Aliphatic index 118.71
GRAVY (25C, pH 7.0) 0.278
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit putative DNA integrity scanning protein
[c]: (8) MG_105_MONOMERMG_105_OCTAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as octamer [PUB_0110].
References
  1. Chen J, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler-Bauer A, Marchler GH, Mazumder R, Nikolskaya AN, Rao BS, Panchenko AR, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, Bryant SH. MMDB: Entrez's 3D-structure database. Nucleic Acids Res 31, 474-7 (2003). WholeCell: PUB_0110, PubMed: 12520055, URL: http://www.ncbi.nlm.nih.gov/Structure/

 
Metadata
Created 2012-10-01 15:07:48
Last updated 2012-10-01 15:14:27