MG_102_MONOMER – thioredoxin-disulfide reductase

Name
WID MG_102_MONOMER View in model
Name thioredoxin-disulfide reductase View in model
Cross references PDB: 1CL0, PDB: 1TRB
 
Genetics
Gene MG_102 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MLKVNADFLTKDQVIYDLVIVGAGPAGIASAIYGKRANLNLAIIEGNTPG
GKIVKTNIVENYPGFKTITGPELGLEMYNHLLAFEPVVFYNNLIKIDHLN
DTFILYLDNKTTVFSKTVIYATGMEERKLGIEKEDYFYGKGISYCAICDA
ALYKGKTVGVVGGGNSAIQEAIYLSSIAKTVHLIHRREVFRSDALLVEKL
KKISNVVFHLNATVKQLIGQEKLQTVKLASTVDKSESEIAIDCLFPYIGF
ESNNKPVLDLKLNLDQNGFILGDENMQTNIKGFYVAGDCRSKSFRQIATA
ISDGVTAVLKVRDDI*
50
100
150
200
250
300
316
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_102_DIMER_ox: 145-148 View in model
Empirical formula (pH 7.5) H2504C1571N404O461S8
Molecular weight (pH 7.5; Da) 34683.54 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
21360
Instability index 29.62
Is stable True
Aliphatic index 106.42
GRAVY (25C, pH 7.0) 0.0570
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit thioredoxin-disulfide reductase
[c]: (2) MG_102_MONOMERMG_102_DIMER
View in model
 
Comments
Comments First observed residue by mass-spec 5 [PUB_0280]. Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 FAD per monomer as coenzyme [96].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:27