MG_101_MONOMER – Uncharacterized HTH-type transcriptional regulator

Name
WID MG_101_MONOMER View in model
Name Uncharacterized HTH-type transcriptional regulator View in model
 
Genetics
Gene MG_101 View in model
 
Structure
Sequence
1
51
101
151
201
MKFGKEIAKKNQIIYRYIILKIQSFEWPANTRIFSERQLEIRFNSSRSQI
RSVLATLLNKNIIRYTKNTPGYFVCKDVGFSFFHKTQDNLKVKYAKLSTL
IKKLLSQDDASVFANIDSTVHLDKFKGIEAKFFDENKKHFLNVCFFAKDD
ILNILDENNLQQQFFREFAYNGIAIEKRHCVTSVDKESGCLVMYDMYYDD
NDNFVVASKSNFLNPELKVINA*
50
100
150
200
223
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 30 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H1841C1185N310O335S7
Molecular weight (pH 7.5; Da) 26014.55 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19410
Instability index 40.70
Is stable False
Aliphatic index 87.00
GRAVY (25C, pH 7.0) -0.321
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Regulation
Regulatory rule !stimulus_gluconate View in model
 
Function
Transcriptional regulation TranscriptionalRegulation_gntR_TU_063: TU_063 View in model
Reaction participant View in model
 
Comments
Comments Consensus sequence ACNNNTATANANNTAT is 18 bp [PUB_0419]. E. coli homolog GntR has 30 nt DNase I footprint [PUB_0727]. Repressed by gluconate [PUB_0110, PUB_0196].
References
  1. Chen J, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler-Bauer A, Marchler GH, Mazumder R, Nikolskaya AN, Rao BS, Panchenko AR, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, Bryant SH. MMDB: Entrez's 3D-structure database. Nucleic Acids Res 31, 474-7 (2003). WholeCell: PUB_0110, PubMed: 12520055, URL: http://www.ncbi.nlm.nih.gov/Structure/

  2. Kalivoda KA, Steenbergen SM, Vimr ER, Plumbridge J. Regulation of sialic acid catabolism by the DNA binding protein NanR in Escherichia coli. J Bacteriol 185, 4806-15 (2003). WholeCell: PUB_0727, PubMed: 12897000

  3. Peekhaus N, Conway T. Positive and negative transcriptional regulation of the Escherichia coli gluconate regulon gene gntT by GntR and the cyclic AMP (cAMP)-cAMP receptor protein complex. J Bacteriol 180, 1777-85 (1998). WholeCell: PUB_0196, PubMed: 9537375

  4. Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic Acids Res 36, D93-6 (2008). WholeCell: PUB_0419, PubMed: 17962296, URL: http://dbtbs.hgc.jp/

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26